Novus Biologicals
Manufacturer Code:NBP155487
Catalog # NBP155487
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACP1(acid phosphatase 1 soluble) The peptide sequence was selected from the N terminal of ACP1. Peptide sequence PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: acid phosphatase 1 soluble acid phosphatase of erythrocyte Adipocyte acid phosphatase cytoplasmic phosphotyrosyl protein phosphatase EC 3.1.3.2 EC 3.1.3.48 HAAP LMW-PTP LMW-PTPase Low molecular weight cytosolic acid phosphatase low molecular weight phosphotyrosine protein phosphatase MGC111030 MGC3499 protein tyrosine phosphatase Red cell acid phosphatase 1; acid phosphatase of erythrocyte; Adipocyte acid phosphatase; cytoplasmic phosphotyrosyl protein phosphatase; LMW-PTP; LMW-PTPase; Low molecular weight cytosolic acid phosphatase; Low molecular weight phosphotyrosine protein phosphatase; protein tyrosine phosphatase; Red cell acid phosphatase 1; testicular secretory protein Li 37
Gene Aliases: ACP1; HAAP; LMW-PTP
UniProt ID: (Human) P24666
Entrez Gene ID: (Human) 52
Molecular Function:
hydrolase
oxidoreductase
phosphatase
protein phosphatase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.