Novus Biologicals
Manufacturer Code:NBP157623
Catalog # NBP157623
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LMOD1(leiomodin 1 (smooth muscle)) The peptide sequence was selected from the N terminal of LMOD1. Peptide sequence SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 64 kDa autoantigen 1D; 64 kDa autoantigen 1D 64 kDa autoantigen 1D31D 64 kDa autoantigen D164kD D1 FLJ55689 leimodin 1 (smooth muscle) leiomodin 1 (smooth muscle) Leiomodin muscle form leiomodin-1 SM-Lmod Smooth muscle leiomodin thyroid and eye muscle autoantigen D1 (64kD) Thyroid-associated ophthalmopathy autoantigen; 64 kDa autoantigen 1D3; 64 kDa autoantigen D1; leimodin 1 (smooth muscle); leiomodin 1 (smooth muscle); Leiomodin, muscle form; Leiomodin-1; SM-Lmod; Smooth muscle leiomodin; thyroid and eye muscle autoantigen D1 (64kD); Thyroid-associated ophthalmopathy autoantigen
Gene Aliases: 1D; 64kD; D1; LMOD1; SM-LMOD; SMLMOD
UniProt ID: (Human) P29536
Entrez Gene ID: (Human) 25802
Molecular Function: actin family cytoskeletal protein cytoskeletal protein non-motor actin binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.