Novus Biologicals
Manufacturer Code:NBP159357
Catalog # NBP159357
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC39A6(solute carrier family 39 (zinc transporter) member 6) The peptide sequence was selected from the middle region of SLC39A6. Peptide sequence RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Estrogen-regulated protein LIV-1; LIV-1 protein, estrogen regulated; solute carrier family 39 (metal ion transporter), member 6; solute carrier family 39 (zinc transporter), member 6; Solute carrier family 39 member 6; Zinc transporter ZIP6; zinc transporter ZIP6 LIV-1 solute carrier family 39 (zinc transporter) member 6; ZIP-6; Zrt- and Irt-like protein 6
Gene Aliases: LIV-1; LIV1; SLC39A6; ZIP6
UniProt ID: (Human) Q13433
Entrez Gene ID: (Human) 25800
Molecular Function: transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.