Novus Biologicals
Manufacturer Code:NBP153082
Catalog # NBP153082
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LIN7C(lin-7 homolog C (C. elegans)) The peptide sequence was selected from the N terminal of LIN7C. Peptide sequence MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ11215 lin-7 homolog C (C. elegans) Lin-7C LIN-7-C MALS-3LIN-7 protein 3 MALS3protein lin-7 homolog C Mammalian lin-seven protein 3 veli-3 VELI3Lin7c Vertebrate lin-7 homolog 3; lin-7 homolog C; LIN-7 protein 3; Lin-7C; MALS-3; Mammalian lin-seven protein 3; Protein lin-7 homolog C; Veli-3; Vertebrate lin-7 homolog 3
Gene Aliases: LIN-7-C; LIN-7C; LIN7C; MALS-3; MALS3; VELI3
UniProt ID: (Human) Q9NUP9
Entrez Gene ID: (Human) 55327
Molecular Function:
cell adhesion molecule
cell junction protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.