Novus Biologicals
Manufacturer Code:NBP234043
Catalog # NBP234043
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IKSFGFVSSGAFAPLTKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVSDQQNG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: abnormal cell LINeage LIN-41; E3 ubiquitin-protein ligase TRIM71; homolog of C. elegans Lin-41; LIN41 LIN-41 tripartite motif containing 71 tripartite motif-containing protein 71; Protein lin-41 homolog; RING-type E3 ubiquitin transferase TRIM71; tripartite motif containing 71, E3 ubiquitin protein ligase; tripartite motif-containing 71; Tripartite motif-containing protein 71
Gene Aliases: LIN-41; LIN41; TRIM71
UniProt ID: (Human) Q2Q1W2
Entrez Gene ID: (Human) 131405
Molecular Function: ubiquitin-protein ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.