Novus Biologicals
Manufacturer Code:NB200526AF594
Catalog # NB20526A594
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide corresponding to a region of human LHX6 with an internal ID of P03556 LSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFS. |
Conjugate | Alexa Fluor 594 |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C in the dark. |
Rabbit Polyclonal Antibody
Protein Aliases: LHX6.1LIM homeobox protein 6 LIM homeobox 6 LIM homeodomain protein 6.1 LIM/homeobox protein Lhx6 LIM/homeobox protein Lhx6.1 MGC119542 MGC119544 MGC119545; LIM homeobox protein 6; LIM homeodomain protein 6.1; LIM/homeobox protein Lhx6; LIM/homeobox protein Lhx6.1
Gene Aliases: LHX6; LHX6.1
UniProt ID: (Human) Q9UPM5
Entrez Gene ID: (Human) 26468
Molecular Function:
RNA binding protein
actin family cytoskeletal protein
cytoskeletal protein
helix-turn-helix transcription factor
homeobox transcription factor
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.