Novus Biologicals
Manufacturer Code:NBP187885
Catalog # NBP187885
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CLL-associated antigen KW-7; CLL-associated antigen KW-7 Dense fine speckles 70 kDa protein DFS70 LEDGFDFS 70 Lens epithelium-derived growth factor MGC74712 p52 p75 PAIP PC4 and SFRS1 interacting protein 1 PC4 and SFRS1 interacting protein 2 PC4 and SFRS1-interacting protein PSIP2 transcriptional coactivator p52/p75 Transcriptional coactivator p75/p52; Dense fine speckles 70 kDa protein; DFS 70; Lens epithelium-derived growth factor; PC4 and SFRS1-interacting protein; transcriptional coactivator p52/p75; Transcriptional coactivator p75/p52
Gene Aliases: DFS70; LEDGF; p52; p75; PAIP; PSIP1; PSIP2
UniProt ID: (Human) O75475
Entrez Gene ID: (Human) 11168
Molecular Function:
growth factor
signaling molecule
transcription cofactor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.