Novus Biologicals
Manufacturer Code:NBP159347
Catalog # NBP159347
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LYCAT(lysocardiolipin acyltransferase) The peptide sequence was selected from the middle region of human LYCAT. Peptide sequence YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acylglycerol-3-phosphate O-acyltransferase 8; 1-acylglycerol-3-phosphate O-acyltransferase 8 1-AGPAT 8 Acyl-CoA:lysocardiolipin acyltransferase 1 AGPAT8lysocardiolipin acyltransferase ALCAT11AGPAT8 EC 2.3.1.- EC 2.3.1.51 FLJ37965 HSRG1849 LYCAT lysocardiolipin acyltransferase 1 UNQ18491-AGP acyltransferase 8; 1-AGP acyltransferase 8; 1-AGPAT 8; Acyl-CoA:lysocardiolipin acyltransferase 1; Lysocardiolipin acyltransferase 1
Gene Aliases: 1AGPAT8; AGPAT8; ALCAT1; HSRG1849; LCLAT1; LYCAT; UNQ1849; UNQ1849/PRO3579
UniProt ID: (Human) Q6UWP7
Entrez Gene ID: (Human) 253558
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.