Novus Biologicals
Manufacturer Code:NBP276537
Catalog # NBP276537
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
Protein Aliases: 1-alkyl-2-acetylglycerophosphocholine esterase; EC 2.3.1.43 lecithin-cholesterol acyltransferasePhospholipid-cholesterol acyltransferase phosphatidylcholine-sterol acyltransferase; Lecithin-cholesterol acyltransferase; PAF acetylhydrolase; phosphatidylcholine--sterol O-acyltransferase; Phosphatidylcholine-sterol acyltransferase; Phospholipid-cholesterol acyltransferase; Platelet-activating factor acetylhydrolase; testicular secretory protein Li 24
Gene Aliases: LCAT
UniProt ID: (Human) P04180
Entrez Gene ID: (Human) 3931
Molecular Function: acyltransferase hydrolase lipase phospholipase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.