Novus Biologicals
Manufacturer Code:NBP15897320UL
Catalog # NBP15897320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LBP(lipopolysaccharide binding protein) The peptide sequence was selected from the middle region of LBP. Peptide sequence LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BPI fold containing family D, member 2; LBP; lipopolysaccharide binding protein lipopolysaccharide-binding protein LPS-binding protein MGC22233; Lipopolysaccharide-binding protein; LPS-binding protein
Gene Aliases: BPIFD2; LBP
UniProt ID: (Human) P18428
Entrez Gene ID: (Human) 3929
Molecular Function:
antibacterial response protein
defense/immunity protein
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.