Novus Biologicals
Manufacturer Code:NBP187332
Catalog # NBP187332
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: L-type amino acid transporter 3; Large neutral amino acids transporter small subunit 3; LAT3prostate cancer overexpressed gene 1 PB39L-type amino acid transporter 3 POV1large neutral amino acids transporter small subunit 3 Prostate cancer overexpressed gene 1 protein R00504 Solute carrier family 43 member 1 solute carrier family 43 member 1; Prostate cancer overexpressed gene 1 protein; SLC43A1; solute carrier family 43 (amino acid system L transporter), member 1; Solute carrier family 43 member 1; solute carrier family 43, member 1
Gene Aliases: LAT3; PB39; POV1; R00504; SLC43A1
UniProt ID: (Human) O75387
Entrez Gene ID: (Human) 8501
Molecular Function:
amino acid transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.