Novus Biologicals
Manufacturer Code:NBP192067
Catalog # NBP192067
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ceramide synthase 1; CerS1; CerS1 LAG1 homolog ceramide synthase 1 LAG1 longevity assurance homolog 1 LAG1MGC90349 longevity assurance (LAG1 S. cerevisiae) homolog 1 Longevity assurance gene 1 protein homolog 1 Protein UOG-1 UOG1LAG1 longevity assurance homolog 1 (S. cerevisiae) upstream of GDF1; LAG1 longevity assurance homolog 1; longevity assurance (LAG1, S. cerevisiae) homolog 1; Longevity assurance gene 1 protein homolog 1; Protein UOG-1; upstream of GDF1
Gene Aliases: CERS1; EPM8; LAG1; LASS1; UOG1
UniProt ID: (Human) P27544
Entrez Gene ID: (Human) 10715
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.