Novus Biologicals
Manufacturer Code:NBP183059
Catalog # NBP183059
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 6.1.1 EC 6.1.1.4 KIAA0028leucine tRNA ligase 2 mitocondrial leucine translase Leucine--tRNA ligase leucyl-tRNA synthetase 2 mitochondrial LEURS MGC26121 probable leucyl-tRNA synthetase mitochondrial; leucine translase; leucine tRNA ligase 2, mitochondrial; leucine tRNA ligase 2, mitocondrial; Leucyl-tRNA synthetase; leucyl-tRNA synthetase 2; LeuRS; Probable leucine--tRNA ligase, mitochondrial; probable leucyl-tRNA synthetase, mitochondrial
Gene Aliases: KIAA0028; LARS2; LEURS; mtLeuRS; PRLTS4
UniProt ID: (Human) Q15031
Entrez Gene ID: (Human) 23395
Molecular Function:
aminoacyl-tRNA synthetase
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.