Novus Biologicals
Manufacturer Code:NBP238478
Catalog # NBP238478
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KWDTERVFEVNASNLEKQTSKGKYFVTFPYPYMNGRLHLGHTFSLSKCEFAVGYQRLKGKCCLFPFGLHCTGMPIKACADKLK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cytoplasmic leucyl-tRNA synthetase; cytoplasmic leucyl-tRNA synthetase FLJ21788 hr025Cl HSPC192 KIAA1352 LARS1 leucine translase leucine tRNA ligase 1 cytoplasmic leucine-tRNA ligase leucine--tRNA ligase leucyl-tRNA synthetase leucyl-tRNA synthetase cytoplasmic LEURS LEUS LRS PIG44; cytosolic leucyl-tRNA synthetase; leucine translase; leucine tRNA ligase 1, cytoplasmic; Leucine--tRNA ligase, cytoplasmic; Leucyl-tRNA synthetase; LeuRS; proliferation-inducing gene 44
Gene Aliases: hr025Cl; HSPC192; ILFS1; KIAA1352; LARS; LARS1; LEURS; LEUS; LFIS; LRS; PIG44; RNTLS
UniProt ID: (Human) Q9P2J5
Entrez Gene ID: (Human) 51520
Molecular Function:
aminoacyl-tRNA synthetase
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.