Novus Biologicals
Manufacturer Code:NBP15994620UL
Catalog # NBP15994620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LARGE(like-glycosyltransferase) The peptide sequence was selected from the middle region of LARGE (NP_004728). Peptide sequence AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acetylglucosaminyltransferase-like 1A; Acetylglucosaminyltransferase-like 1A EC 2.4 glycosyltransferase-like protein LARGE1 KIAA0609acetylglucosaminyltransferase-like protein LARGE1 like-acetylglucosaminyltransferase like-glycosyltransferase MDC1D MDDGA6 MDDGB6; acetylglucosaminyltransferase-like protein; Beta-1,3-glucuronyltransferase LARGE; Glycosyltransferase-like protein; LARGE xylosyl- and glucuronyltransferase 1; like-glycosyltransferase; Xylosyltransferase LARGE
Gene Aliases: KIAA0609; LARGE; LARGE1; MDC1D; MDDGA6; MDDGB6
UniProt ID: (Human) O95461
Entrez Gene ID: (Human) 9215
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.