Novus Biologicals
Manufacturer Code:NBP159416
Catalog # NBP159416
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to LAPTM4B(lysosomal associated protein transmembrane 4 beta) The peptide sequence was selected from the middle region of LAPTM4B. Peptide sequence YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: LAPTM4beta LC27 lysosomal associated protein transmembrane 4 beta lysosomal protein transmembrane 4 beta lysosomal-associated transmembrane protein 4B Lysosome-associated transmembrane protein 4-beta; lysosomal associated protein transmembrane 4 beta; Lysosomal-associated transmembrane protein 4B; Lysosome-associated transmembrane protein 4-beta
Gene Aliases: LAPTM4B; LAPTM4beta; LC27; PSEC0001
UniProt ID: (Human) Q86VI4
Entrez Gene ID: (Human) 55353
Molecular Function: transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.