Novus Biologicals
Manufacturer Code:NBP182848
Catalog # NBP182848
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QENWHEGKENIRAAVAAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cysteinylglycine-S-conjugate dipeptidase; Cytosol aminopeptidase; EC 3.4.11 EC 3.4.11.5 LAP LAPEPEC 3.4.11.1 leucine aminopeptidase 3Prolyl aminopeptidase Leucyl aminopeptidase PEPScytosol aminopeptidase Peptidase SLAP-3 Proline aminopeptidase; epididymis secretory protein Li 106; LAP-3; Leucine aminopeptidase 3; Leucyl aminopeptidase; Peptidase S; Proline aminopeptidase; Prolyl aminopeptidase
Gene Aliases: HEL-S-106; LAP; LAP3; LAPEP; PEPS
UniProt ID: (Human) P28838
Entrez Gene ID: (Human) 51056
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.