Novus Biologicals
Manufacturer Code:NBP156736
Catalog # NBP156736
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C13ORF31 The peptide sequence was selected from the middle region of C13ORF31. Peptide sequence TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adenosine deaminase LACC1; chromosome 13 open reading frame 31 DKFZp686D11119 FLJ38725 hypothetical protein LOC144811; Fatty acid metabolism-immunity nexus; Guanosine phosphorylase LACC1; laccase (multicopper oxidoreductase) domain containing 1; Laccase domain-containing protein 1; Purine nucleoside phosphorylase LACC1; S-methyl-5'-thioadenosine phosphorylase LACC1
Gene Aliases: C13orf31; FAMIN; LACC1
UniProt ID: (Human) Q8IV20
Entrez Gene ID: (Human) 144811
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.