Novus Biologicals
Manufacturer Code:NBP180097
Catalog # NBP180097
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human KCNAB2. Peptide sequence KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hKvbeta2; HKvbeta2 HKvbeta2.1 HKvbeta2.2 K(+) channel subunit beta-2 K+ channel beta-2 subunit KCNA2BAKR6A5 KCNK2 KV-BETA-2 MGC117289 potassium channel shaker chain beta 2 potassium voltage-gated channel shaker-related subfamily beta member 2 voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; potassium channel, voltage gated subfamily A regulatory beta subunit 2; potassium voltage-gated channel, shaker-related subfamily, beta member 2; Voltage-gated potassium channel subunit beta-2
Gene Aliases: AKR6A5; HKvbeta2; HKvbeta2.1; HKvbeta2.2; KCNA2B; KCNAB2; KCNK2; KV-BETA-2
UniProt ID: (Human) Q13303
Entrez Gene ID: (Human) 8514
Molecular Function:
ion channel
oxidoreductase
potassium channel
reductase
transporter
voltage-gated ion channel
voltage-gated potassium channel
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.