Novus Biologicals
Manufacturer Code:NBP255954
Catalog # NBP255954
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 80kDa ATP-dependent DNA helicase 2 subunit 2 ATP-dependent DNA helicase II 80 kDa subunit CTC85 CTCBF EC 3.6.4.- FLJ39089 G22P2 KARP1 KARP-1 KU80 Ku86 autoantigen related protein 186 kDa subunit of Ku antigen Ku86DNA repair protein XRCC5 KUB2 NFIV Thyroid-lupus autoantigen TLAA X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining Ku autoantigen 80kD) X-ray repair cross-complementing protein 5 X-ray repair complementing defective repair in Chinese hamster; 86 kDa subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 2; ATP-dependent DNA helicase II 80 kDa subunit; CTC box-binding factor 85 kDa subunit; CTC85; CTCBF; DNA repair protein XRCC5; Ku autoantigen, 80kDa; Ku80; Ku86; Ku86 autoantigen related protein 1; Lupus Ku autoantigen protein p86; Nuclear factor IV; Thyroid-lupus autoantigen; TLAA; X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining); X-ray repair cross-complementing protein 5
Gene Aliases: G22P2; KARP-1; KARP1; KU80; Ku86; KUB2; NFIV; XRCC5
UniProt ID: (Human) P13010
Entrez Gene ID: (Human) 7520
Molecular Function: DNA binding protein DNA helicase helicase nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.