Invitrogen
Manufacturer Code:PA577570
Catalog # PIPA577570
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (Frozen) (IHC (F)) | Assay dependent |
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM corresponding to amino acids 342-391 of rat ROMK1 |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | -20°C |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP-regulated potassium channel ROM-K; ATP-sensitive inward rectifier potassium channel 1; Inward rectifier K(+) channel Kir1.1; inwardly rectifying K+ channel; inwardly rectifying potassium channel ROMK-2; K+ channel protein; KAB-1; kir1.1; Potassium channel, inwardly rectifying subfamily J member 1; potassium channel, inwardly rectifying subfamily J, member 1; Potassium inwardly-rectifying channel subfamily J; potassium inwardly-rectifying channel, subfamily J, member 1; ROMK1 Kcnj1
Gene Aliases: Kcnj; KCNJ1; KIR1.1; ROMK; ROMK1; Romk2
UniProt ID: (Human) P48048, (Mouse) O88335
Entrez Gene ID: (Human) 3758, (Mouse) 56379, (Rat) 24521
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.