Novus Biologicals
Manufacturer Code:NBP170595
Catalog # NBP170595
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KRT222P(keratin 222 pseudogene) The peptide sequence was selected from the N terminal of KRT222P. Peptide sequence ELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: keratin 222 pseudogene; keratin 222 truncated type I keratin KA21; keratin 222, type II; Keratin-222; Keratin-222 pseudogene; Keratin-like protein KRT222
Gene Aliases: KA21; KRT222; KRT222P
UniProt ID: (Human) Q8N1A0
Entrez Gene ID: (Human) 125113
Molecular Function: cytoskeletal protein intermediate filament structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.