Novus Biologicals
Manufacturer Code:NBP152978
Catalog # NBP152978
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KPNA5(karyopherin alpha 5 (importin alpha 6)) The peptide sequence was selected from the C terminal of KPNA5. Peptide sequence TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: importin alpha 6; importin alpha 6 importin subunit alpha-6 IPOA6 karyopherin alpha 5 (importin alpha 6) Karyopherin subunit alpha-5 SRP6; Importin subunit alpha-6; karyopherin alpha 5 (importin alpha 6); Karyopherin subunit alpha-5
Gene Aliases: IPOA6; KPNA5; SRP6
UniProt ID: (Human) O15131
Entrez Gene ID: (Human) 3841
Molecular Function:
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.