Novus Biologicals
Manufacturer Code:NBP152976
Catalog # NBP152976
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KPNA3(karyopherin alpha 3 (importin alpha 4)) The peptide sequence was selected from the N terminal of KPNA3. Peptide sequence AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: hSRP1 importin alpha 4 Importin alpha Q2 importin alpha-3 importin subunit alpha-3 importin-alpha-Q2 IPOA4 karyopherin alpha 3 (importin alpha 4) Karyopherin subunit alpha-3 QIP2 SRP1 SRP1gamma SRP1-gamma SRP4; importin alpha 4; Importin alpha Q2; importin alpha-3; importin subunit alpha-3; Importin subunit alpha-4; importin-alpha-Q2; karyopherin alpha 3 (importin alpha 4); Karyopherin subunit alpha-3; Qip2; SRP1-gamma
Gene Aliases: hSRP1; IPOA4; KPNA3; QIP2; SRP1; SRP1gamma; SRP4
UniProt ID: (Human) O00505
Entrez Gene ID: (Human) 3839
Molecular Function:
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.