Novus Biologicals
Manufacturer Code:NBP15546220UL
Catalog # NBP15546220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KLHL7(kelch-like 7 (Drosophila)) The peptide sequence was selected from the middle region of KLHL7. Peptide sequence AVGSIVYVLAGFQGVGRLGHILEYNTETDKWVANSKVRAFPVTSCLICVV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: kelch (Drosophila)-like 6 kelch/BTB kelch-like 6 kelch-like 7 (Drosophila) kelch-like protein 7 KLHL6 RP42 SBBI26; kelch-like 6; kelch-like 7; kelch-like family member 7; Kelch-like protein 7; kelch/BTB
Gene Aliases: KLHL6; KLHL7; SBBI26
UniProt ID: (Human) Q8IXQ5
Entrez Gene ID: (Human) 55975
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.