Novus Biologicals
Manufacturer Code:NBP15656520UL
Catalog # NBP15656520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KIAA0907(KIAA0907) The peptide sequence was selected from the middle region of KIAA0907. Peptide sequence ELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERER. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BLOM7 KIAA0907 nuclear ribonucleoprotein K homology domain protein RP11-336K24.1; Brings lots of money 7; KH homology domain-containing protein 4; Pre-mRNA splicing factor protein KHDC4
Gene Aliases: BLOM7; KHDC4; KIAA0907; SNORA80EHG
UniProt ID: (Human) Q7Z7F0
Entrez Gene ID: (Human) 22889
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.