Novus Biologicals
Manufacturer Code:NBP16265320UL
Catalog # NBP16265320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KDELR3(KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3) The peptide sequence was selected form the middle region of KDELR3. Peptide sequence AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ER lumen protein retaining receptor 3; ER lumen protein retaining receptor 3 ERD2L3 KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3 KDEL endoplasmic reticulum protein retention receptor 3 KDEL receptor 3; ER lumen protein-retaining receptor 3; KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum protein retention receptor 3; KDEL endoplasmic reticulum protein retention receptor 3; KDEL receptor 3
Gene Aliases: ERD2L3; KDELR3
UniProt ID: (Human) O43731
Entrez Gene ID: (Human) 11015
Molecular Function:
membrane traffic protein
membrane trafficking regulatory protein
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.