Novus Biologicals
Manufacturer Code:NBP255448
Catalog # NBP255448
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSPEKSEIWGPGLKADVVLPARYFYIQAVDTSGNKFTSSPGEKVFQVKVSAPEEQFTRVGVQVLDRKDGSF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Endoplasmic reticulum resident protein 58; Endoplasmic reticulum resident protein 58 EP58KDEL1 ER protein 58 ERp58 KDEL (Lys-Asp-Glu-Leu) containing 1 KDEL motif-containing 1 KDEL motif-containing protein 1 MGC5302; ER protein 58; KDEL (Lys-Asp-Glu-Leu) containing 1; KDEL motif-containing 1; KDEL motif-containing protein 1; Protein O-glucosyltransferase 2; Protein O-xylosyltransferase POGLUT2
Gene Aliases: EP58; ERp58; KDEL1; KDELC1; POGLUT2; UNQ1910/PRO4357
UniProt ID: (Human) Q6UW63
Entrez Gene ID: (Human) 79070
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.