Novus Biologicals
Manufacturer Code:NBP15770820UL
Catalog # NBP15770820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KCTD16 (potassium channel tetramerisation domain containing 16) The peptide sequence was selected from the N terminal of KCTD16. Peptide sequence KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BTB/POZ domain-containing protein KCTD16; BTB/POZ domain-containing protein KCTD16 DKFZp781A1155 KIAA1317Potassium channel tetramerization domain-containing protein 16 MGC138167 potassium channel tetramerisation domain containing 16; potassium channel tetramerisation domain containing 16; Potassium channel tetramerization domain-containing protein 16
Gene Aliases: KCTD16; KIAA1317
UniProt ID: (Human) Q68DU8
Entrez Gene ID: (Human) 57528
Molecular Function:
enzyme modulator
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.