Novus Biologicals
Manufacturer Code:NBP256583
Catalog # NBP256583
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: big potassium channel beta subunit 4; BK channel beta subunit 4; BK channel subunit beta-4; BK channel subunit beta-4 BKbeta4 calcium-activated potassium channel subunit beta-4 Calcium-activated potassium channel subfamily M subunit beta-4 Charybdotoxin receptor subunit beta-4 hbeta4 K(VCA)beta-4 large conductance calcium-dependent potassium ion channel beta 4 subunit Maxi K channel subunit beta-4 potassium large conductance calcium-activated channel subfamily M beta member4 slo-beta-4; BKbeta4; Calcium-activated potassium channel subunit beta-4; Calcium-activated potassium channel, subfamily M subunit beta-4; Charybdotoxin receptor subunit beta-4; hbeta4; K(VCA)beta-4; large conductance calcium-dependent potassium ion channel beta 4 subunit; Maxi K channel subunit beta-4; MaxiK channel beta-subunit 4; potassium channel subfamily M regulatory beta subunit 4; potassium large conductance calcium-activated channel, subfamily M, beta member 4; Slo-beta-4
Gene Aliases: KCNMB4
UniProt ID: (Human) Q86W47
Entrez Gene ID: (Human) 27345
Molecular Function: ion channel potassium channel transporter voltage-gated ion channel voltage-gated potassium channel
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.