Invitrogen
Manufacturer Code:PA577586
Catalog # PIPA577586
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | GST fusion protein with the sequence SHSSHSSQ SSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMG QAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIP PIREVEDEC corresponding to residues 1097-1196 of mouse KCa 1.1 variant 2 |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | -20°C |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: big potassium channel alpha subunit; BK channel; BK channel alpha subunit; BKCA alpha; BKCA alpha subunit; BKCa KCNMA1 SLO; calcium-activated potassium channel alpha subunit; Calcium-activated potassium channel subunit alpha-1; Calcium-activated potassium channel, subfamily M subunit alpha-1; K(VCA)alpha; KCa1.1; Maxi K channel; maxi-K channel HSLO; MaxiK; mSlo1; potassium channel, calcium activated large conductance subfamily M alpha, member 1; potassium large conductance calcium-activated channel, subfamily M, alpha member 1; Slo homolog; Slo-alpha; Slo1; Slowpoke homolog; stretch-activated Kca channel
Gene Aliases: 5730414M22Rik; bA205K10.1; BKCa; BKTM; hSlo; KCa1.1; KCNMA; KCNMA1; KCNMA1b; KCNMA1c; MaxiK; mSlo; mSLO1; SAKCA; SLO; SLO-ALPHA; SLO1
UniProt ID: (Human) Q12791, (Mouse) Q08460, (Rat) Q7TQ56
Entrez Gene ID: (Human) 3778, (Mouse) 16531, (Rat) 83731
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.