Novus Biologicals
Manufacturer Code:NBP169621
Catalog # NBP169621
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to KCNK4(potassium channel subfamily K member 4) The peptide sequence was selected from the N terminal of KCNK4. Peptide sequence ELGEVREKFLRAHPCVSDQELGLLIKEVADALGGGADPETNSTSNSSHSA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: K2p4.1 K2P4.1 potassium channel potassium channel subfamily K member 4 potassium channel subfamily K member 4 TRAAKTRAAK1 TWIK-related arachidonic acid-stimulated potassium channel protein Two pore K(+) channel KT4.1 two pore K+ channel KT4.1 Two pore potassium channel KT4.1; K2P4.1 potassium channel; Potassium channel subfamily K member 4; potassium channel, subfamily K, member 4; potassium channel, two pore domain subfamily K, member 4; TRAAK; TWIK-related arachidonic acid-stimulated potassium channel protein; Two pore K(+) channel KT4.1; two pore K+ channel KT4.1; Two pore potassium channel KT4.1
Gene Aliases: K2p4.1; KCNK4; TRAAK; TRAAK1
UniProt ID: (Human) Q9NYG8
Entrez Gene ID: (Human) 50801
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.