Novus Biologicals
Manufacturer Code:NBP181570
Catalog # NBP181570
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ILSTSYNRFRKFPFFTRPLLSKWCPKSLFKKKPDPKPADEAVPQIIISAEELPGPKLGTCPSR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: K2p18.1 potassium channel subfamily K member 18 potassium channel subfamily K member 18 TRESK2 TRESK-2 TRESKTWIK-related spinal cord potassium channel TRIKMGR13 TWIK-related individual K+ channel TWIK-related individual potassium channel TWIK-related spinal cord K+ channel; Potassium channel subfamily K member 18; potassium channel, subfamily K, member 18; potassium channel, two pore domain subfamily K, member 18; TWIK-related individual K+ channel; TWIK-related individual potassium channel; TWIK-related spinal cord K+ channel; TWIK-related spinal cord potassium channel
Gene Aliases: K2p18.1; KCNK18; MGR13; TRESK; TRESK-2; TRESK2; TRIK
UniProt ID: (Human) Q7Z418
Entrez Gene ID: (Human) 338567
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.