Novus Biologicals
Manufacturer Code:NBP192041
Catalog # NBP192041
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2P domain potassium channel Talk-2; Acid-sensitive potassium channel protein TASK-4; Acid-sensitive potassium channel protein TASK-4 K2p17.1 potassium channel subfamily K member 17 potassium channel subfamily K member 17 TALK22P domain potassium channel Talk-2 TALK-2TWIK-related alkaline pH-activated K(+) channel 2 TASK-4 TASK4TWIK-related acid-sensitive K(+) channel 4; Potassium channel subfamily K member 17; potassium channel, two pore domain subfamily K, member 17; TALK-2; TWIK-related acid-sensitive K(+) channel 4; TWIK-related alkaline pH-activated K(+) channel 2
Gene Aliases: K2p17.1; KCNK17; TALK-2; TALK2; TASK-4; TASK4; UNQ5816/PRO19634
UniProt ID: (Human) Q96T54
Entrez Gene ID: (Human) 89822
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.