Novus Biologicals
Manufacturer Code:NBP18008420UL
Catalog # NBP18008420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human KCNK12. Peptide sequence EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Potassium channel subfamily K member 12; potassium channel subfamily K member 12 potassium channel subfamily K member 12 tandem pore domain potassium channel THIK-2 THIK2 THIK-2 THIK-2THIK2Tandem pore domain halothane-inhibited potassium channel 2; potassium channel, subfamily K, member 12; potassium channel, two pore domain subfamily K, member 12; Tandem pore domain halothane-inhibited potassium channel 2; tandem pore domain potassium channel THIK-2; THIK-2
Gene Aliases: K2p12.1; KCNK12; THIK-2; THIK2
UniProt ID: (Human) Q9HB15
Entrez Gene ID: (Human) 56660
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.