Novus Biologicals
Manufacturer Code:NBP185133
Catalog # NBP185133
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp434F076 KCC4Electroneutral potassium-chloride cotransporter 4 K-Cl cotransporter 4 potassium/chloride transporter KCC4 solute carrier family 12 (potassium/chloride transporters) member 7 solute carrier family 12 member 7; Electroneutral potassium-chloride cotransporter 4; K-Cl cotransporter 4; potassium/chloride transporter KCC4; solute carrier family 12 (potassium/chloride transporter), member 7; solute carrier family 12 (potassium/chloride transporters), member 7; Solute carrier family 12 member 7
Gene Aliases: KCC4; SLC12A7
UniProt ID: (Human) Q9Y666
Entrez Gene ID: (Human) 10723
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.