Novus Biologicals
Manufacturer Code:NBP189282
Catalog # NBP189282
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ACCPN agenesis of corpus callosum and peripheral neuropathy (Andermann syndrome) DKFZp434D2135 EC 1.2.4.1 EC 6.1.1.3 Electroneutral potassium-chloride cotransporter 3 KCC3A KCC3B KCC3potassium chloride cotransporter 3 K-Cl cotransporter 3 potassium chloride cotransporter KCC3a-S3 potassium-chloride transporter-3a potassium-chloride transporter-3b solute carrier family 12 (potassium/chloride transporters) member 6 solute carrier family 12 member 6; Electroneutral potassium-chloride cotransporter 3; K-Cl cotransporter 3; potassium chloride cotransporter 3; potassium chloride cotransporter KCC3a-S3; potassium-chloride transporter-3a; potassium-chloride transporter-3b; solute carrier family 12 (potassium/chloride transporter), member 6; solute carrier family 12 (potassium/chloride transporters), member 6; Solute carrier family 12 member 6
Gene Aliases: ACCPN; KCC3; KCC3A; KCC3B; SLC12A6
UniProt ID: (Human) Q9UHW9
Entrez Gene ID: (Human) 9990
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.