Novus Biologicals
Manufacturer Code:NBP174063
Catalog # NBP174063
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the N terminal of Slc12a5. Immunizing peptide sequence TDCEDGDGGANPGDGNPKESSPFINSTDTEKGREYDGRNMALFEEEMDTS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Electroneutral potassium-chloride cotransporter 2; Electroneutral potassium-chloride cotransporter 2 hKCC2 KCC2K-Cl cotransporter 2 KIAA1176erythroid K-Cl cotransporter 2 Neuronal K-Cl cotransporter solute carrier family 12 (potassium/chloride transporter) member 5 solute carrier family 12 member 5; erythroid K-Cl cotransporter 2; hKCC2; K-Cl cotransporter 2; Neuronal K-Cl cotransporter; solute carrier family 12 (potassium/chloride transporter), member 5; Solute carrier family 12 member 5
Gene Aliases: EIEE34; EIG14; hKCC2; KCC2; KIAA1176; SLC12A5
UniProt ID: (Human) Q9H2X9
Entrez Gene ID: (Human) 57468
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.