Novus Biologicals
Manufacturer Code:NBP183067
Catalog # NBP183067
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Electroneutral potassium-chloride cotransporter 1; Electroneutral potassium-chloride cotransporter 1 Erythroid K-Cl cotransporter 1 FLJ17069 FLJ40489 hKCC1 KCC1erythroid K:Cl cotransporter K-Cl cotransporter potassium/chloride cotransporter 1 solute carrier family 12 (potassium/chloride transporters) member 4 solute carrier family 12 member 4; Erythroid K-Cl cotransporter 1; hKCC1; potassium/chloride cotransporter 1; solute carrier family 12 (potassium/chloride transporter), member 4; solute carrier family 12 (potassium/chloride transporters), member 4; Solute carrier family 12 member 4
Gene Aliases: CTC-479C5.17; hKCC1; KCC1; SLC12A4
UniProt ID: (Human) F5H066
Entrez Gene ID: (Human) 6560
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.