Novus Biologicals
Manufacturer Code:NBP180310
Catalog # NBP180310
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human KBTBD10. Peptide sequence AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ60989 kelch repeat and BTB (POZ) domain containing 10 kelch repeat and BTB domain-containing protein 10 Kelch-related protein 1 Kel-like protein 23 KRP1 Sarcosin SARCOSINsarcomeric muscle protein; Kel-like protein 23; kelch repeat and BTB (POZ) domain containing 10; Kelch repeat and BTB domain-containing protein 10; kelch-like family member 41; Kelch-like protein 41; Kelch-related protein 1; sarcomeric muscle protein; Sarcosin
Gene Aliases: KBTBD10; KLHL41; KRP1; SARCOSIN
UniProt ID: (Human) O60662
Entrez Gene ID: (Human) 10324
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.