Novus Biologicals
Manufacturer Code:NBP230452
Catalog # NBP230452
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NAHPRRGQIIDFQGLLTDAIKGATSELALNTFDHNPDPSERLLKPLSAFIGMNSEMRELAAVVSRDIYLHNPNIKWNDIIGLDA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp667C165 EC 3.6.4.3 katanin p60 ATPase-containing subunit A-like 2 katanin p60 subunit A-like 2DKFZP667C165 MGC33211 p60 katanin-like 2; katanin catalytic subunit A like 2; Katanin p60 ATPase-containing subunit A-like 2; katanin p60 subunit A like 2; Katanin p60 subunit A-like 2; KATNAL2; p60 katanin-like 2
Gene Aliases: KATNAL2
UniProt ID: (Human) Q8IYT4
Entrez Gene ID: (Human) 83473
Molecular Function:
cytoskeletal protein
microtubule family cytoskeletal protein
non-motor microtubule binding protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.