Novus Biologicals
Manufacturer Code:NBP239014
Catalog # NBP239014
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: E3 SUMO-protein ligase TRIM28; E3 SUMO-protein ligase TRIM28 EC 6.3.2.- FLJ29029 KAP-1 KAP1KRAB-associated protein 1 KRIP-1 Nuclear corepressor KAP-1 RNF96KRAB-interacting protein 1 TF1B TIF1-beta TIF1BRING finger protein 96 transcription intermediary factor 1-beta transcriptional intermediary factor 1-beta tripartite motif containing 28 tripartite motif-containing 28 Tripartite motif-containing protein 28; KAP-1; KRAB [Kruppel-associated box domain]-associated protein 1; KRAB-associated protein 1; KRAB-interacting protein 1; KRIP-1; Nuclear corepressor KAP-1; protein phosphatase 1, regulatory subunit 157; RING finger protein 96; RING-type E3 ubiquitin transferase TIF1-beta; TIF1-beta; Transcription intermediary factor 1-beta; transcriptional intermediary factor 1-beta; Tripartite motif-containing protein 28
Gene Aliases: KAP1; PPP1R157; RNF96; TF1B; TIF1B; TRIM28
UniProt ID: (Human) Q13263
Entrez Gene ID: (Human) 10155
Molecular Function:
transcription cofactor
ubiquitin-protein ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.