Novus Biologicals
Manufacturer Code:NBP18027020UL
Catalog # NBP18027020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human GRIK5. Peptide sequence EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EAA2; EAA2 Excitatory amino acid receptor 2 glutamate receptor KA2 Glutamate receptor KA-2 glutamate receptor ionotropic kainate 5 glutamate receptor ionotropic kainate 5 KA2GRIK2; Excitatory amino acid receptor 2; GluK5; Glutamate receptor ionotropic, kainate 5; Glutamate receptor KA-2; glutamate receptor KA2; glutamate receptor, ionotropic, kainate 5; KA2
Gene Aliases: EAA2; GluK5; GRIK2; GRIK5; KA2
UniProt ID: (Human) Q16478
Entrez Gene ID: (Human) 2901
Molecular Function:
ion channel
ionotropic glutamate receptor
ligand-gated ion channel
receptor
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.