Novus Biologicals
Manufacturer Code:NBP256324
Catalog # NBP256324
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C-Jun-amino-terminal kinase-interacting protein 1; IB-1; Islet-brain 1; JIP-1; JNK MAP kinase scaffold protein 1; JNK-interacting protein 1; Mitogen-activated protein kinase 8-interacting protein 1; PRKM8 interacting protein
Gene Aliases: IB1; JIP-1; JIP1; MAPK8IP1; PRKM8IP
UniProt ID: (Human) Q9UQF2
Entrez Gene ID: (Human) 9479
Molecular Function:
enzyme modulator
kinase activator
kinase modulator
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.