Novus Biologicals
Manufacturer Code:NBP179714
Catalog # NBP179714
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen this antibody was a synthetic peptide directed towards the C terminal region of human JHDM1D. Sequence: CGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: histone lysine demethylase JHDM1D; JmjC domain-containing histone demethylation protein 1D; jmjC domain-containing histone demethylation protein 1D jumonji C domain containing histone demethylase 1 homolog D (S. cerevisiae) KDM7A; jumonji C domain containing histone demethylase 1 homolog D; jumonji C domain-containing histone demethylase 1 homolog D; lysine (K)-specific demethylase 7A; Lysine-specific demethylase 7; Lysine-specific demethylase 7A
Gene Aliases: JHDM1D; KDM7; KDM7A; KIAA1718
UniProt ID: (Human) Q6ZMT4
Entrez Gene ID: (Human) 80853
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.