Novus Biologicals
Manufacturer Code:NBP238934
Catalog # NBP238934
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD321; CD321 antigen F11 receptor JAM-1 JAM1CD321 JAMA JAM-A JCAMJAM Junctional adhesion molecule 1Platelet F11 receptor junctional adhesion molecule A PAM-1KAT Platelet adhesion molecule 1; JAM-1; JAM-A; Junctional adhesion molecule 1; Junctional adhesion molecule A; PAM-1; Platelet adhesion molecule 1; Platelet F11 receptor
Gene Aliases: CD321; F11R; JAM; JAM1; JAMA; JCAM; KAT; PAM-1; UNQ264/PRO301
UniProt ID: (Human) Q9Y624
Entrez Gene ID: (Human) 50848
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.