Novus Biologicals
Manufacturer Code:NBP15536220UL
Catalog # NBP15536220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to IARS(isoleucyl-tRNA synthetase) The peptide sequence was selected from the N terminal of IARS. Peptide sequence SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 6.1.1 EC 6.1.1.5 FLJ20736 IARS1 ILERS ILRS IRS isoleucine tRNA ligase 1 cytoplasmic Isoleucine--tRNA ligase isoleucyl-tRNA synthetase isoleucyl-tRNA synthetase cytoplasmic PRO0785; IRS; isoleucine tRNA ligase 1, cytoplasmic; Isoleucine--tRNA ligase, cytoplasmic; Isoleucyl-tRNA synthetase; isoleucyl-tRNA synthetase, cytoplasmic
Gene Aliases: IARS; IARS1; ILERS; ILRS; IRS; PRO0785
UniProt ID: (Human) P41252
Entrez Gene ID: (Human) 3376
Molecular Function:
aminoacyl-tRNA synthetase
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.