Novus Biologicals
Manufacturer Code:NBP234091
Catalog # NBP234091
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cytosolic NADP-isocitrate dehydrogenase; Cytosolic NADP-isocitrate dehydrogenase EC 1.1.1.42 IDCD IDH IDP IDPC isocitrate dehydrogenase [NADP] cytoplasmic isocitrate dehydrogenase 1 (NADP+) soluble NADP(+)-specific ICDH NADP-dependent isocitrate dehydrogenase cytosolic NADP-dependent isocitrate dehydrogenase peroxisomal Oxalosuccinate decarboxylase PICD; epididymis luminal protein 216; epididymis secretory protein Li 26; IDH; IDP; isocitrate dehydrogenase 1 (NADP+); isocitrate dehydrogenase 1 (NADP+), soluble; Isocitrate dehydrogenase [NADP] cytoplasmic; NADP(+)-specific ICDH; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; Oxalosuccinate decarboxylase
Gene Aliases: HEL-216; HEL-S-26; IDCD; IDH; IDH1; IDP; IDPC; PICD
UniProt ID: (Human) O75874
Entrez Gene ID: (Human) 3417
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.