Novus Biologicals
Manufacturer Code:NBP159940
Catalog # NBP159940
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ITGA8(integrin alpha 8) The peptide sequence was selected from the N terminal of ITGA8. Peptide sequence GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: integrin alpha 8; Integrin alpha-8; Integrin alpha-8 heavy chain; integrin alpha-8 integrin alpha 8; Integrin alpha-8 light chain; integrin, alpha 8
Gene Aliases: ITGA8
UniProt ID: (Human) P53708
Entrez Gene ID: (Human) 8516
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.