Novus Biologicals
Manufacturer Code:NBP184580
Catalog # NBP184580
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alphaIIb protein; CD41; CD41 CD41 antigen CD41BHPA3 GP2Bintegrin alpha-IIb GPalpha IIb GPIIb GTA integrin alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex antigenCD41) integrin alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex antigenCD41B) ITGAB platelet fibrinogen receptor alpha subunit Platelet membrane glycoprotein IIb platelet-specific antigen BAK; GPalpha IIb; GPIIb; Integrin alpha-IIb; Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet-specific antigen BAK; protein phosphatase 1, regulatory subunit 93
Gene Aliases: BDPLT16; BDPLT2; CD41; CD41B; GP2B; GPIIb; GT; GTA; HPA3; ITGA2B; ITGAB; PPP1R93
UniProt ID: (Human) P08514
Entrez Gene ID: (Human) 3674
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.